![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) ![]() |
![]() | Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
![]() | Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
![]() | Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries) |
![]() | Domain d1kbpa1: 1kbp A:9-120 [22349] Other proteins in same PDB: d1kbpa2, d1kbpb2, d1kbpc2, d1kbpd2 complexed with fe, nag, zn |
PDB Entry: 1kbp (more details), 2.65 Å
SCOPe Domain Sequences for d1kbpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbpa1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d1kbpa1: