SCOPe 2.08: Domain d1kb9e2: 1kb9 E:31-86

Lineage for d1kb9e2 (1kb9 E:31-86)

Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
annotated by the SCOP(e) curators as 'not a true fold'
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries)

Domain d1kb9e2: 1kb9 E:31-86 [77320]
Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9e2

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex

PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOPe Domain Sequences for d1kb9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOPe Domain Coordinates for d1kb9e2:

Click to download the PDB-style file with coordinates for d1kb9e2.
(The format of our PDB-style files is described here.)

Timeline for d1kb9e2: