Lineage for d1katv_ (1kat V:)
- Root: SCOPe 2.06
Class g: Small proteins [56992] (94 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
disulfide-rich fold; common core is all-betaSuperfamily g.17.1: Cystine-knot cytokines [57501] (8 families) 
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) Protein Vascular endothelial growth factor, VEGF [57505] (3 species) Species Human (Homo sapiens) [TaxId:9606] [57506] (20 PDB entries)
Uniprot P15692 40-133
Domain d1katv_: 1kat V: [77309]
complexed with a phage-derived peptide antagonist, chains X and Y
Details for d1katv_
PDB Entry: 1kat (more details)
PDB Description: solution structure of a phage-derived peptide antagonist in complex with vascular endothelial growth factor
PDB Compounds: (V:) vascular endothelial growth factorSCOPe Domain Sequences for d1katv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1katv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
SCOPe Domain Coordinates for d1katv_:
Click to download the PDB-style file with coordinates for d1katv_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1katv_:
- d1katv_ first appeared in SCOP 1.63
- d1katv_ appears in SCOPe 2.05
- d1katv_ appears in SCOPe 2.07
- d1katv_ appears in the current release, SCOPe 2.08
View in 3D
