Lineage for d1katv_ (1kat V:)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
disulfide-rich fold; common core is all-betaSuperfamily g.17.1: Cystine-knot cytokines [57501] (7 families) 
Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins) Protein Vascular endothelial growth factor, VEGF [57505] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
Uniprot P15692 40-133
Domain d1katv_: 1kat V: [77309]
complexed with a phage-derived peptide antagonist, chains X and Y
Details for d1katv_
PDB Entry: 1kat (more details)
PDB Description: solution structure of a phage-derived peptide antagonist in complex with vascular endothelial growth factor
PDB Compounds: (V:) vascular endothelial growth factorSCOP Domain Sequences for d1katv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1katv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
SCOP Domain Coordinates for d1katv_:
Click to download the PDB-style file with coordinates for d1katv_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1katv_:
- d1katv_ first appeared in SCOP 1.63
- d1katv_ appears in SCOP 1.73
- d1katv_ appears in SCOPe 2.01
- d1katv_ appears in the current release, SCOPe 2.08
View in 3D
