Lineage for d1k9ja_ (1k9j A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 737926Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. 737927Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries)
  8. 737929Domain d1k9ja_: 1k9j A: [68353]

Details for d1k9ja_

PDB Entry: 1k9j (more details), 1.9 Å

PDB Description: complex of dc-signr and glcnac2man3
PDB Compounds: (A:) mDC-SIGN2 TYPE I ISOFORM

SCOP Domain Sequences for d1k9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ja_ d.169.1.1 (A:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
crhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnr
fswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvd
nywickkpaa

SCOP Domain Coordinates for d1k9ja_:

Click to download the PDB-style file with coordinates for d1k9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ja_: