Lineage for d1k9ja_ (1k9j A:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (8 families) 
Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
Pfam PF00059
Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries) 
Domain d1k9ja_: 1k9j A: [68353]
Details for d1k9ja_
PDB Entry: 1k9j (more details), 1.9 Å
PDB Description: complex of dc-signr and glcnac2man3
PDB Compounds: (A:) mDC-SIGN2 TYPE I ISOFORMSCOP Domain Sequences for d1k9ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9ja_ d.169.1.1 (A:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
crhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnr
fswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvd
nywickkpaa
SCOP Domain Coordinates for d1k9ja_:
Click to download the PDB-style file with coordinates for d1k9ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k9ja_:
- d1k9ja_ first appeared in SCOP 1.59
- d1k9ja_ appears in SCOP 1.71
- d1k9ja_ appears in SCOP 1.75
- d1k9ja_ appears in the current release, SCOPe 2.08
View in 3D
