Class b: All beta proteins [48724] (174 folds) |
Fold b.111: Small protein B (SmpB) [74981] (1 superfamily) barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold |
Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) |
Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein) |
Protein Small protein B (SmpB) [74984] (2 species) tmRNA-binding protein; SsrA-binding protein |
Species Aquifex aeolicus [TaxId:63363] [74985] (4 PDB entries) |
Domain d1k8ha_: 1k8h A: [72176] |
PDB Entry: 1k8h (more details)
SCOP Domain Sequences for d1k8ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ha_ b.111.1.1 (A:) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]} gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv lialakgkklydr
Timeline for d1k8ha_: