Lineage for d1k79a_ (1k79 A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.21: ets domain [46859] (9 proteins) Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)
Uniprot P27577 301-440
Domain d1k79a_: 1k79 A: [68262]
protein/DNA complex
Details for d1k79a_
PDB Entry: 1k79 (more details), 2.4 Å
PDB Description: Ets-1(331-440)+GGAA duplex
PDB Compounds: (A:) c-ets-1 proteinSCOPe Domain Sequences for d1k79a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k79a_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus) [TaxId: 10090]}
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk
SCOPe Domain Coordinates for d1k79a_:
Click to download the PDB-style file with coordinates for d1k79a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k79a_:
- d1k79a_ first appeared in SCOP 1.59
- d1k79a_ appears in SCOPe 2.05
- d1k79a_ appears in SCOPe 2.07
- d1k79a_ appears in the current release, SCOPe 2.08
View in 3D
