![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Negative transcriptional regulator NmrA [69407] (1 species) has an UDP-galactose 4-epimerase-like structure but evolved a different function |
![]() | Species Emericella nidulans (Aspergillus nidulans) [TaxId:162425] [69408] (6 PDB entries) Uniprot O59919 |
![]() | Domain d1k6jb_: 1k6j B: [68225] complexed with cl has additional subdomain(s) that are not in the common domain |
PDB Entry: 1k6j (more details), 1.8 Å
SCOPe Domain Sequences for d1k6jb_:
Sequence, based on SEQRES records: (download)
>d1k6jb_ c.2.1.2 (B:) Negative transcriptional regulator NmrA {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} aqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpll nnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygp wpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapf dpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvt yvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkga gagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
>d1k6jb_ c.2.1.2 (B:) Negative transcriptional regulator NmrA {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} aqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpll nnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygp wpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapf dpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvt yvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrqrvtdearklwsgwrdm eeyarevfpieeeangldwml
Timeline for d1k6jb_: