Lineage for d1k5da_ (1k5d A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846662Protein Ran [52609] (2 species)
  7. 1846687Species Human (Homo sapiens) [TaxId:9606] [52611] (40 PDB entries)
  8. 1846734Domain d1k5da_: 1k5d A: [68168]
    Other proteins in same PDB: d1k5db_, d1k5dc_, d1k5de_, d1k5df_, d1k5dh_, d1k5di_, d1k5dk_, d1k5dl_
    complexed with gnp, mg

Details for d1k5da_

PDB Entry: 1k5d (more details), 2.7 Å

PDB Description: Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d1k5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5da_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpded

SCOPe Domain Coordinates for d1k5da_:

Click to download the PDB-style file with coordinates for d1k5da_.
(The format of our PDB-style files is described here.)

Timeline for d1k5da_: