Lineage for d1k4sa2 (1k4s A:201-430)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885019Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 885020Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
  5. 885021Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 885022Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 885025Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765
    Uniprot P11387 203-767
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 885039Domain d1k4sa2: 1k4s A:201-430 [77262]
    Other proteins in same PDB: d1k4sa1
    complexed with ido, ptr, spt

Details for d1k4sa2

PDB Entry: 1k4s (more details), 3.2 Å

PDB Description: human dna topoisomerase i in covalent complex with a 22 base pair dna duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOP Domain Sequences for d1k4sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4sa2 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOP Domain Coordinates for d1k4sa2:

Click to download the PDB-style file with coordinates for d1k4sa2.
(The format of our PDB-style files is described here.)

Timeline for d1k4sa2: