Lineage for d1k3ub_ (1k3u B:)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) Protein Tryptophan synthase, beta-subunit [53688] (2 species) Species Salmonella typhimurium [TaxId:90371] [53689] (42 PDB entries) 
Domain d1k3ub_: 1k3u B: [72031]
Other proteins in same PDB: d1k3ua_
complexed with iad, na, plp
Details for d1k3ub_
PDB Entry: 1k3u (more details), 1.7 Å
PDB Description: crystal structure of wild-type tryptophan synthase complexed with n- [1h-indol-3-yl-acetyl]aspartic acid
PDB Compounds: (B:) tryptophan synthase beta chainSCOP Domain Sequences for d1k3ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ub_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 602]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg
SCOP Domain Coordinates for d1k3ub_:
Click to download the PDB-style file with coordinates for d1k3ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k3ub_:
- d1k3ub_ first appeared in SCOP 1.61
- d1k3ub_ appears in SCOP 1.71
- d1k3ub_ appears in SCOP 1.75
- d1k3ub_ appears in the current release, SCOPe 2.08
View in 3D
