Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins) |
Protein Uridine phosphorylase [53176] (2 species) |
Species Escherichia coli [TaxId:562] [53177] (13 PDB entries) also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP |
Domain d1k3fa_: 1k3f A: [68105] |
PDB Entry: 1k3f (more details), 2.5 Å
SCOP Domain Sequences for d1k3fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3fa_ c.56.2.1 (A:) Uridine phosphorylase {Escherichia coli [TaxId: 562]} msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh avkivveaarrll
Timeline for d1k3fa_: