![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins) |
![]() | Protein Phosphomannomutase/phosphoglucomutase, N-terminal domain [419008] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [419480] (12 PDB entries) |
![]() | Domain d1k2yx1: 1k2y X:5-154 [68063] Other proteins in same PDB: d1k2yx2, d1k2yx3, d1k2yx4 complexed with tla, zn; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1k2y (more details), 1.75 Å
SCOPe Domain Sequences for d1k2yx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2yx1 c.84.1.1 (X:5-154) Phosphomannomutase/phosphoglucomutase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} kaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpel vkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgahnppdyngfkivvage tlaneqiqalreriekndlasgvgsveqvd
Timeline for d1k2yx1: