Lineage for d1k2wa_ (1k2w A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
Protein Sorbitol dehydrogenase [102148] (1 species) Species Rhodobacter sphaeroides [TaxId:1063] [102149] (1 PDB entry) 
Domain d1k2wa_: 1k2w A: [90927]
Details for d1k2wa_
PDB Entry: 1k2w (more details), 2.4 Å
PDB Description: crystal structure of sorbitol dehydrogenase from r. sphaeroides
PDB Compounds: (A:) sorbitol dehydrogenaseSCOPe Domain Sequences for d1k2wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}
mrldgktalitgsargigrafaeayvregarvaiadinleaarataaeigpaacaialdv
tdqasidrcvaelldrwgsidilvnnaalfdlapiveitresydrlfainvsgtlfmmqa
varamiaggrggkiinmasqagrrgealvgvycatkaavisltqsaglnlirhginvnai
apgvvdgehwdgvdakfadyenlprgekkrqvgaavpfgrmgraedltgmaiflatpead
yivaqtynvdggnwms
SCOPe Domain Coordinates for d1k2wa_:
Click to download the PDB-style file with coordinates for d1k2wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k2wa_:
- d1k2wa_ first appeared in SCOP 1.67
- d1k2wa_ appears in SCOPe 2.03
- d1k2wa_ appears in SCOPe 2.05
- d1k2wa_ appears in the current release, SCOPe 2.08
View in 3D
