Lineage for d1k2pa_ (1k2p A:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Bruton's tyrosine kinase (Btk) [75564] (1 species)
PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [75565] (1 PDB entry) 
Domain d1k2pa_: 1k2p A: [72012]
Details for d1k2pa_
PDB Entry: 1k2p (more details), 2.1 Å
PDB Description: Crystal structure of Bruton's tyrosine kinase domain
PDB Compounds: (A:) Tyrosine-protein kinase BTKSCOPe Domain Sequences for d1k2pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]}
idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
kaderptfkillsnildv
SCOPe Domain Coordinates for d1k2pa_:
Click to download the PDB-style file with coordinates for d1k2pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k2pa_:
- d1k2pa_ first appeared in SCOP 1.61
- d1k2pa_ appears in SCOPe 2.01
- d1k2pa_ appears in SCOPe 2.03
- d1k2pa_ appears in the current release, SCOPe 2.08
View in 3D
