Lineage for d1k2oa_ (1k2o A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (108 PDB entries)
Uniprot P00183
Domain d1k2oa_: 1k2o A: [68061]
complexed with cac, hem, rfa, rfb
Details for d1k2oa_
PDB Entry: 1k2o (more details), 1.65 Å
PDB Description: cytochrome p450cam with bound bis(2,2'-bipyridine)-(5-methyl-2-2'- bipyridine)-c2-adamantane ruthenium (ii)
PDB Compounds: (A:) cytochrome p450camSCOPe Domain Sequences for d1k2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2oa_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOPe Domain Coordinates for d1k2oa_:
Click to download the PDB-style file with coordinates for d1k2oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k2oa_:
- d1k2oa_ first appeared in SCOP 1.59
- d1k2oa_ appears in SCOPe 2.03
- d1k2oa_ appears in SCOPe 2.05
- d1k2oa_ appears in the current release, SCOPe 2.08
View in 3D
