Lineage for d1k2ha_ (1k2h A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733398Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1733399Protein Calcyclin (S100) [47479] (17 species)
  7. 1733578Species Norway rat (Rattus norvegicus), s100a1 [TaxId:10116] [69019] (4 PDB entries)
  8. 1733583Domain d1k2ha_: 1k2h A: [68056]
    apo-form

Details for d1k2ha_

PDB Entry: 1k2h (more details)

PDB Description: three-dimensional solution structure of apo-s100a1.
PDB Compounds: (A:) S-100 protein, alpha chain

SCOPe Domain Sequences for d1k2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2ha_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100a1 [TaxId: 10116]}
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens

SCOPe Domain Coordinates for d1k2ha_:

Click to download the PDB-style file with coordinates for d1k2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k2ha_:

1733583
d1k2ha_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1k2hb_