Lineage for d1k2da2 (1k2d A:4-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183231Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2183326Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)
  8. 2183330Domain d1k2da2: 1k2d A:4-81 [84292]
    Other proteins in same PDB: d1k2da1, d1k2da3, d1k2db1, d1k2db2
    complexed with nag, ndg

Details for d1k2da2

PDB Entry: 1k2d (more details), 2.2 Å

PDB Description: crystal structure of the autoimmune mhc class ii i-au complexed with myelin basic protein 1-11 at 2.2a
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOPe Domain Sequences for d1k2da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2da2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
dhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgglqn
iatgkhnlgvltkrsnstp

SCOPe Domain Coordinates for d1k2da2:

Click to download the PDB-style file with coordinates for d1k2da2.
(The format of our PDB-style files is described here.)

Timeline for d1k2da2: