![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
![]() | Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) ![]() duplication: consists of 2 subdomains of this fold |
![]() | Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
![]() | Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries) |
![]() | Domain d1k25a2: 1k25 A:693-750 [68034] Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4 |
PDB Entry: 1k25 (more details), 3.2 Å
SCOPe Domain Sequences for d1k25a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k25a2 d.11.1.1 (A:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} veeipdmygwkketaetfakwldielefegsgsvvqkqdvrtntaiknikkikltlgd
Timeline for d1k25a2: