Lineage for d1k1aa_ (1k1a A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238947Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2238948Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2238949Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2238970Protein bcl-3 [69091] (1 species)
    a member of the I-kappa-B family
  7. 2238971Species Human (Homo sapiens) [TaxId:9606] [69092] (2 PDB entries)
  8. 2238972Domain d1k1aa_: 1k1a A: [67992]

Details for d1k1aa_

PDB Entry: 1k1a (more details), 1.86 Å

PDB Description: Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family
PDB Compounds: (A:) B-cell lymphoma 3-encoded protein

SCOPe Domain Sequences for d1k1aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]}
edgdtplhiavvqgnlpavhrlvnlfqqggreldiynnlrqtplhlavittlpsvvrllv
tagaspmaldrhgqtaahlacehrsptclralldsaapgtldlearnydgltalhvavnt
ecqetvqlllergadidavdiksgrsplihavennslsmvqlllqhganvnaqmysgssa
lhsasgrgllplvrtlvrsgadsslknchndtplmvarsrrvidilrg

SCOPe Domain Coordinates for d1k1aa_:

Click to download the PDB-style file with coordinates for d1k1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1k1aa_: