Lineage for d1k0xa_ (1k0x A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053983Protein Melanoma inhibitory activity protein [63746] (1 species)
  7. 2053984Species Human (Homo sapiens) [TaxId:9606] [63747] (4 PDB entries)
  8. 2053989Domain d1k0xa_: 1k0x A: [71977]

Details for d1k0xa_

PDB Entry: 1k0x (more details)

PDB Description: solution structure of melanoma inhibitory activity protein
PDB Compounds: (A:) melanoma derived growth regulatory protein

SCOPe Domain Sequences for d1k0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0xa_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]}
mgpmpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlf
wggsvqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq

SCOPe Domain Coordinates for d1k0xa_:

Click to download the PDB-style file with coordinates for d1k0xa_.
(The format of our PDB-style files is described here.)

Timeline for d1k0xa_: