SCOPe 2.08: Domain d1k0ua2: 1k0u A:2-189,A:353-431

Lineage for d1k0ua2 (1k0u A:2-189,A:353-431)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)
Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
Protein S-adenosylhomocystein hydrolase [52301] (3 species)
contains additional secondary structures disguising the superfamily fold
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
Domain d1k0ua2: 1k0u A:2-189,A:353-431 [67971]
Other proteins in same PDB: d1k0ua1, d1k0ub1, d1k0uc1, d1k0ud1, d1k0ue1, d1k0uf1, d1k0ug1, d1k0uh1
complexed with dea, nad

Details for d1k0ua2

PDB Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine

PDB Compounds: (A:) s-adenosyl-l-homocysteine hydrolase

SCOPe Domain Sequences for d1k0ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ua2 c.23.12.3 (A:2-189,A:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOPe Domain Coordinates for d1k0ua2:

Click to download the PDB-style file with coordinates for d1k0ua2.
(The format of our PDB-style files is described here.)

Timeline for d1k0ua2: