SCOPe 2.07: Domain d1k0ua1: 1k0u A:190-352

Lineage for d1k0ua1 (1k0u A:190-352)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
this domain interrupts the other domain which defines family
Protein S-adenosylhomocystein hydrolase [51845] (3 species)
Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries)
Domain d1k0ua1: 1k0u A:190-352 [67970]
Other proteins in same PDB: d1k0ua2, d1k0ub2, d1k0uc2, d1k0ud2, d1k0ue2, d1k0uf2, d1k0ug2, d1k0uh2
complexed with dea, nad

Details for d1k0ua1

PDB Entry: 1k0u (more details), 3 Å

PDB Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine

PDB Compounds: (A:) s-adenosyl-l-homocysteine hydrolase

SCOPe Domain Sequences for d1k0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ua1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

SCOPe Domain Coordinates for d1k0ua1:

Click to download the PDB-style file with coordinates for d1k0ua1.
(The format of our PDB-style files is described here.)

Timeline for d1k0ua1: