Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.7: CheW-like [50341] (2 families) automatically mapped to Pfam PF01584 |
Family b.40.7.1: CheW-like [50342] (3 proteins) duplication: tandem repeat of two swapped domains, one with a canonical OB-fold topology and one with a circular permutation |
Protein Chemotaxis protein CheW [69271] (1 species) |
Species Thermotoga maritima [TaxId:2336] [69272] (2 PDB entries) |
Domain d1k0sa_: 1k0s A: [67969] |
PDB Entry: 1k0s (more details)
SCOPe Domain Sequences for d1k0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0sa_ b.40.7.1 (A:) Chemotaxis protein CheW {Thermotoga maritima [TaxId: 2336]} mktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgrii pvvnlakilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgk kskglvktdgrliiyldidkiieeitvkegv
Timeline for d1k0sa_: