Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein Transcription factor NusA, C-terminal domains [69701] (2 species) duplication: tandem repeat of two type II KH-domains |
Species Mycobacterium tuberculosis [TaxId:1773] [69703] (3 PDB entries) |
Domain d1k0ra3: 1k0r A:263-329 [67963] Other proteins in same PDB: d1k0ra1, d1k0ra4, d1k0ra5, d1k0rb1, d1k0rb4, d1k0rb5 complexed with so4 |
PDB Entry: 1k0r (more details), 1.7 Å
SCOPe Domain Sequences for d1k0ra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ra3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} dparfvanalspakvvsvsvidqtaraarvvvpdfqlslaigkegqnarlaarltgwrid irgdapp
Timeline for d1k0ra3: