Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Chloride intracellular channel 1 (clic1) [69514] (1 species) similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition |
Species Human (Homo sapiens) [TaxId:9606] [69515] (4 PDB entries) |
Domain d1k0ma2: 1k0m A:6-91 [67950] Other proteins in same PDB: d1k0ma1, d1k0mb1 |
PDB Entry: 1k0m (more details), 1.4 Å
SCOPe Domain Sequences for d1k0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp fllygtevhtdtnkieefleavlcpp
Timeline for d1k0ma2: