Lineage for d1k07a_ (1k07 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) 
Protein Zn metallo-beta-lactamase [56283] (12 species) 
Species Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId:464] [82802] (5 PDB entries) 
Domain d1k07a_: 1k07 A: [77218]
complexed with act, gol, so4, zn
Details for d1k07a_
PDB Entry: 1k07 (more details), 1.65 Å
PDB Description: Native FEZ-1 metallo-beta-lactamase from Legionella gormanii
PDB Compounds: (A:) FEZ-1 beta-lactamaseSCOPe Domain Sequences for d1k07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]}
ypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfkf
sdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyftq
stvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpgy
klvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdptg
cknyieqkandfytelkkqetg
SCOPe Domain Coordinates for d1k07a_:
Click to download the PDB-style file with coordinates for d1k07a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k07a_:
- d1k07a_ first appeared in SCOP 1.63
- d1k07a_ appears in SCOPe 2.06
- d1k07a_ appears in the current release, SCOPe 2.08
View in 3D
