Lineage for d1k05b_ (1k05 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083851Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 1083852Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
  6. 1083853Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 1083858Species Human (Homo sapiens) [TaxId:9606] [68996] (5 PDB entries)
  8. 1083867Domain d1k05b_: 1k05 B: [67906]

Details for d1k05b_

PDB Entry: 1k05 (more details), 2.9 Å

PDB Description: Crystal structure of the Focal Adhesion Targeting Domain of Focal Adhesion Kinase
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1k05b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k05b_ a.24.14.1 (B:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
pqeisppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtll
atvdetipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaah
alavdaknlldvidqarlkmlg

SCOPe Domain Coordinates for d1k05b_:

Click to download the PDB-style file with coordinates for d1k05b_.
(The format of our PDB-style files is described here.)

Timeline for d1k05b_: