![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Lipocalin q83 [89364] (1 species) activated expression by the myc oncogene |
![]() | Species Common quail (Coturnix coturnix) [TaxId:9091] [89365] (1 PDB entry) |
![]() | Domain d1jzua_: 1jzu A: [84271] |
PDB Entry: 1jzu (more details)
SCOPe Domain Sequences for d1jzua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]} mtvpdrseiagkwyvvalasntefflrekdkmkmamarisflgedelkvsyavpkpngcr kwettfkktsddgevyyseeakkkvevldtdyksyaviyatrvkdgrtlhmmrlysrspe vspaataifrklagernytdemvamlprqeectvdev
Timeline for d1jzua_: