Lineage for d1jzua_ (1jzu A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 958085Protein Lipocalin q83 [89364] (1 species)
    activated expression by the myc oncogene
  7. 958086Species Common quail (Coturnix coturnix) [TaxId:9091] [89365] (1 PDB entry)
  8. 958087Domain d1jzua_: 1jzu A: [84271]

Details for d1jzua_

PDB Entry: 1jzu (more details)

PDB Description: cell transformation by the myc oncogene activates expression of a lipocalin: analysis of the gene (q83) and solution structure of its protein product
PDB Compounds: (A:) lipocalin Q83

SCOPe Domain Sequences for d1jzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]}
mtvpdrseiagkwyvvalasntefflrekdkmkmamarisflgedelkvsyavpkpngcr
kwettfkktsddgevyyseeakkkvevldtdyksyaviyatrvkdgrtlhmmrlysrspe
vspaataifrklagernytdemvamlprqeectvdev

SCOPe Domain Coordinates for d1jzua_:

Click to download the PDB-style file with coordinates for d1jzua_.
(The format of our PDB-style files is described here.)

Timeline for d1jzua_: