Lineage for d1jz8a2 (1jz8 A:626-730)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768158Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1768159Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1768173Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 1768175Domain d1jz8a2: 1jz8 A:626-730 [67831]
    Other proteins in same PDB: d1jz8a3, d1jz8a4, d1jz8a5, d1jz8b3, d1jz8b4, d1jz8b5, d1jz8c3, d1jz8c4, d1jz8c5, d1jz8d3, d1jz8d4, d1jz8d5
    complexed with dms, lak, mg, na, tar

Details for d1jz8a2

PDB Entry: 1jz8 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with allolactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1jz8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz8a2 b.1.4.1 (A:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1jz8a2:

Click to download the PDB-style file with coordinates for d1jz8a2.
(The format of our PDB-style files is described here.)

Timeline for d1jz8a2: