Lineage for d1jxka1 (1jxk A:404-491)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555683Protein Animal alpha-amylase [51024] (3 species)
  7. 1555684Species Human (Homo sapiens) [TaxId:9606] [51026] (47 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 1555701Domain d1jxka1: 1jxk A:404-491 [63316]
    Other proteins in same PDB: d1jxka2
    complexed with ca, cl

Details for d1jxka1

PDB Entry: 1jxk (more details), 1.9 Å

PDB Description: role of ethe mobile loop in the mehanism of human salivary amylase
PDB Compounds: (A:) Alpha-amylase, salivary

SCOPe Domain Sequences for d1jxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxka1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1jxka1:

Click to download the PDB-style file with coordinates for d1jxka1.
(The format of our PDB-style files is described here.)

Timeline for d1jxka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxka2