Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (164 PDB entries) Uniprot P00734 331-361,364-421 Uniprot P00734 334-360 364-510 518-619 Uniprot P00734 328-620 Uniprot P00734 355-621 Uniprot P00734 328-620 Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620 |
Domain d1jwta_: 1jwt A: [67398] complexed with bli |
PDB Entry: 1jwt (more details), 2.5 Å
SCOP Domain Sequences for d1jwta_:
Sequence, based on SEQRES records: (download)
>d1jwta_ b.47.1.2 (A:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfgedfeei peeyl
>d1jwta_ b.47.1.2 (A:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl ketwgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfgedfeeipeeyl
Timeline for d1jwta_: