Lineage for d1jwqa_ (1jwq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889915Family c.56.5.6: N-acetylmuramoyl-L-alanine amidase-like [102517] (2 proteins)
    automatically mapped to Pfam PF01520
  6. 2889919Protein N-acetylmuramoyl-L-alanine amidase CwlV [102518] (1 species)
  7. 2889920Species Paenibacillus polymyxa [TaxId:1406] [102519] (1 PDB entry)
  8. 2889921Domain d1jwqa_: 1jwq A: [90921]
    complexed with zn

Details for d1jwqa_

PDB Entry: 1jwq (more details), 1.8 Å

PDB Description: structure of the catalytic domain of cwlv, n-acetylmuramoyl-l-alanine amidase from bacillus(paenibacillus) polymyxa var.colistinus
PDB Compounds: (A:) N-ACETYLMURAMOYL-L-ALANINE AMIDASE CwlV

SCOPe Domain Sequences for d1jwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwqa_ c.56.5.6 (A:) N-acetylmuramoyl-L-alanine amidase CwlV {Paenibacillus polymyxa [TaxId: 1406]}
mkvvvidaghgakdsgavgisrknyektfnlamalkvesilkqnpklevvltrsddtfle
lkqrvkvaenlkanvfvsihanssgssasngtetyyqrsaskafanvmhkyfapatgltd
rgirygnfhvirettmpavllevgylsnakeeatlfdedfqnrvaqgiadgiteyldvk

SCOPe Domain Coordinates for d1jwqa_:

Click to download the PDB-style file with coordinates for d1jwqa_.
(The format of our PDB-style files is described here.)

Timeline for d1jwqa_: