Lineage for d1jwmd2 (1jwm D:122-239)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
Uniprot P23313
Domain d1jwmd2: 1jwm D:122-239 [84241]
Other proteins in same PDB: d1jwma1, d1jwma2, d1jwmb1, d1jwmb2, d1jwmd1
Details for d1jwmd2
PDB Entry: 1jwm (more details), 2.7 Å
PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1(HA peptide 306-318) with the Superantigen SEC3
PDB Compounds: (D:) Enterotoxin type C-3SCOPe Domain Sequences for d1jwmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwmd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
SCOPe Domain Coordinates for d1jwmd2:
Click to download the PDB-style file with coordinates for d1jwmd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jwmd2:
- d1jwmd2 first appeared in SCOP 1.65
- d1jwmd2 appears in SCOPe 2.06
- d1jwmd2 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1jwma1, d1jwma2, d1jwmb1, d1jwmb2 |
