Lineage for d1jwmd1 (1jwm D:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789011Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2789012Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2789026Domain d1jwmd1: 1jwm D:1-121 [84240]
    Other proteins in same PDB: d1jwma1, d1jwma2, d1jwmb1, d1jwmb2, d1jwmd2

Details for d1jwmd1

PDB Entry: 1jwm (more details), 2.7 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1(HA peptide 306-318) with the Superantigen SEC3
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1jwmd1:

Sequence, based on SEQRES records: (download)

>d1jwmd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1jwmd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

SCOPe Domain Coordinates for d1jwmd1:

Click to download the PDB-style file with coordinates for d1jwmd1.
(The format of our PDB-style files is described here.)

Timeline for d1jwmd1:

2789026
d1jwmd1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1jwmd2