Lineage for d1juoa_ (1juo A:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) 
Protein Sorcin [69023] (2 species) Species Human (Homo sapiens) [TaxId:9606] [69024] (1 PDB entry) 
Domain d1juoa_: 1juo A: [67312]
Details for d1juoa_
PDB Entry: 1juo (more details), 2.2 Å
PDB Description: Crystal Structure of Calcium-free Human Sorcin: A Member of the Penta-EF-Hand Protein Family
PDB Compounds: (A:) sorcinSCOPe Domain Sequences for d1juoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}
fpgqtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdm
sgtmgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiak
rystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
SCOPe Domain Coordinates for d1juoa_:
Click to download the PDB-style file with coordinates for d1juoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1juoa_:
- d1juoa_ first appeared in SCOP 1.59
- d1juoa_ appears in SCOPe 2.02
- d1juoa_ appears in SCOPe 2.04
- d1juoa_ appears in the current release, SCOPe 2.08
View in 3D
