Lineage for d1ju5a_ (1ju5 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.93: SH2-like [55549] (1 superfamily)
3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helicesSuperfamily d.93.1: SH2 domain [55550] (2 families) 
Family d.93.1.1: SH2 domain [55551] (35 proteins)
Pfam PF00017
Protein Crk proto-oncogen [82741] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82742] (2 PDB entries) 
Domain d1ju5a_: 1ju5 A: [77173]
Other proteins in same PDB: d1ju5c_
complex with the Crk-derived phophopeptide and Abl SH3 domain
Details for d1ju5a_
PDB Entry: 1ju5 (more details)
PDB Description: ternary complex of an crk sh2 domain, crk-derived phophopeptide, and abl sh3 domain by nmr spectroscopy
PDB Compounds: (A:) CrkSCOPe Domain Sequences for d1ju5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ju5a_ d.93.1.1 (A:) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]}
swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv
ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr
SCOPe Domain Coordinates for d1ju5a_:
Click to download the PDB-style file with coordinates for d1ju5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ju5a_:
- d1ju5a_ first appeared in SCOP 1.63
- d1ju5a_ appears in SCOPe 2.06
- d1ju5a_ appears in the current release, SCOPe 2.08
View in 3D
