Lineage for d1ju3a1 (1ju3 A:352-574)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-rollSuperfamily b.18.1: Galactose-binding domain-like [49785] (35 families) 
Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) Protein Bacterial cocaine esterase, C-terminal domain [69223] (1 species) Species Rhodococcus sp. mb1 [TaxId:51612] [69224] (4 PDB entries) 
Domain d1ju3a1: 1ju3 A:352-574 [67300]
Other proteins in same PDB: d1ju3a2
complexed with pbc
Details for d1ju3a1
PDB Entry: 1ju3 (more details), 1.58 Å
PDB Description: bacterial cocaine esterase complex with transition state analog
PDB Compounds: (A:) cocaine esteraseSCOPe Domain Sequences for d1ju3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ju3a1 b.18.1.13 (A:352-574) Bacterial cocaine esterase, C-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr
SCOPe Domain Coordinates for d1ju3a1:
Click to download the PDB-style file with coordinates for d1ju3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ju3a1:
- d1ju3a1 first appeared in SCOP 1.59
- d1ju3a1 appears in SCOPe 2.07
View in 3D
