Lineage for d1jtka_ (1jtk A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the restSuperfamily c.97.1: Cytidine deaminase-like [53927] (7 families) 
contains extra C-terminal strand 5, order 21345
Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
strand 5 is antiparallel to strand 4
Protein mono-domain cytidine deaminase [75327] (5 species) Species Bacillus subtilis [TaxId:1423] [75328] (4 PDB entries)
Uniprot P19079
Domain d1jtka_: 1jtk A: [71862]
complexed with thu, zn
Details for d1jtka_
PDB Entry: 1jtk (more details), 2.04 Å
PDB Description: crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine
PDB Compounds: (A:) Cytidine deaminaseSCOPe Domain Sequences for d1jtka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtka_ c.97.1.1 (A:) mono-domain cytidine deaminase {Bacillus subtilis [TaxId: 1423]}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedlh
SCOPe Domain Coordinates for d1jtka_:
Click to download the PDB-style file with coordinates for d1jtka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jtka_:
- d1jtka_ first appeared in SCOP 1.61
- d1jtka_ appears in SCOPe 2.06
- d1jtka_ appears in the current release, SCOPe 2.08
View in 3D
