Lineage for d1jt1a_ (1jt1 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679371Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1679372Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1679442Species Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId:464] [82802] (3 PDB entries)
  8. 1679445Domain d1jt1a_: 1jt1 A: [77168]
    complexed with cl, gol, mco, so4, zn

Details for d1jt1a_

PDB Entry: 1jt1 (more details), 1.78 Å

PDB Description: FEZ-1 metallo-beta-lactamase from Legionella gormanii modelled with D-captopril
PDB Compounds: (A:) FEZ-1, class B3 metallo-beta-lactamase

SCOPe Domain Sequences for d1jt1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt1a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]}
ypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfkf
sdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyftq
stvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpgy
klvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdptg
cknyieqkandfytelkkqetg

SCOPe Domain Coordinates for d1jt1a_:

Click to download the PDB-style file with coordinates for d1jt1a_.
(The format of our PDB-style files is described here.)

Timeline for d1jt1a_: