Lineage for d1jsya2 (1jsy A:176-399)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.11: Arrestin/Vps26-like [81291] (1 protein) Protein Arrestin [49244] (2 species)
duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-headSpecies Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (4 PDB entries) 
Domain d1jsya2: 1jsy A:176-399 [71848]
Details for d1jsya2
PDB Entry: 1jsy (more details), 2.9 Å
PDB Description: Crystal structure of bovine arrestin-2
PDB Compounds: (A:) Bovine arrestin-2 (full length)SCOPe Domain Sequences for d1jsya2:
Sequence, based on SEQRES records: (download)
>d1jsya2 b.1.18.11 (A:176-399) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfarqrlkgm
Sequence, based on observed residues (ATOM records): (download)
>d1jsya2 b.1.18.11 (A:176-399) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsssdvavelpftlmhpkdddivfedf
arqrlkgm
SCOPe Domain Coordinates for d1jsya2:
Click to download the PDB-style file with coordinates for d1jsya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jsya2:
- d1jsya2 first appeared in SCOP 1.61
- d1jsya2 appears in SCOPe 2.01
- d1jsya2 appears in SCOPe 2.03
- d1jsya2 appears in the current release, SCOPe 2.08
View in 3D
