Lineage for d1js1x1 (1js1 X:1-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906826Protein Transcarbamylase-like protein [75308] (1 species)
  7. 2906827Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries)
  8. 2906828Domain d1js1x1: 1js1 X:1-163 [71834]
    Other proteins in same PDB: d1js1x3, d1js1y3, d1js1z3
    complexed with po4

Details for d1js1x1

PDB Entry: 1js1 (more details), 2 Å

PDB Description: crystal structure of a new transcarbamylase from the anaerobic bacterium bacteroides fragilis at 2.0 a resolution
PDB Compounds: (X:) Transcarbamylase

SCOPe Domain Sequences for d1js1x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js1x1 c.78.1.1 (X:1-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
mkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaaln
lgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenrey
dyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykk

SCOPe Domain Coordinates for d1js1x1:

Click to download the PDB-style file with coordinates for d1js1x1.
(The format of our PDB-style files is described here.)

Timeline for d1js1x1: