Lineage for d1jrja_ (1jrj A:)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1470747Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1470748Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1470749Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1470765Protein Exendin-4 [70005] (1 species)
    glucagone-like hormone
  7. 1470766Species Synthetic [70006] (3 PDB entries)
  8. 1470769Domain d1jrja_: 1jrj A: [67135]

Details for d1jrja_

PDB Entry: 1jrj (more details)

PDB Description: solution structure of exendin-4 in 30-vol% trifluoroethanol
PDB Compounds: (A:) Exendin-4

SCOPe Domain Sequences for d1jrja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrja_ j.6.1.1 (A:) Exendin-4 {Synthetic}
hgegtftsdlskqmeeeavrlfiewlknggpssgappps

SCOPe Domain Coordinates for d1jrja_:

Click to download the PDB-style file with coordinates for d1jrja_.
(The format of our PDB-style files is described here.)

Timeline for d1jrja_: