Lineage for d1jqza_ (1jqz A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543032Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1543033Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1543047Species Human (Homo sapiens) [TaxId:9606] [50359] (84 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1543073Domain d1jqza_: 1jqz A: [67109]
    complexed with fmt

Details for d1jqza_

PDB Entry: 1jqz (more details), 1.65 Å

PDB Description: Human Acidic Fibroblast Growth Factor. 141 Amino Acid Form with Amino Terminal His Tag.
PDB Compounds: (A:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqza_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
ckrgprthygqkailflplpv

SCOPe Domain Coordinates for d1jqza_:

Click to download the PDB-style file with coordinates for d1jqza_.
(The format of our PDB-style files is described here.)

Timeline for d1jqza_: