Lineage for d1jpfa2 (1jpf A:2-181)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) 
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries) 
Domain d1jpfa2: 1jpf A:2-181 [67017]
Other proteins in same PDB: d1jpfa1, d1jpfb_
Details for d1jpfa2
PDB Entry: 1jpf (more details), 2.18 Å
PDB Description: crystal structure of the lcmv peptidic epitope gp276 in complex with the murine class i mhc molecule h-2db
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chainSCOPe Domain Sequences for d1jpfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpfa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
SCOPe Domain Coordinates for d1jpfa2:
Click to download the PDB-style file with coordinates for d1jpfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jpfa2:
- d1jpfa2 first appeared in SCOP 1.59
- d1jpfa2 appears in SCOPe 2.07
View in 3D
