Lineage for d1jpaa_ (1jpa A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein ephb2 receptor tyrosine kinase [69827] (1 species)
PTK group; Eph/Elk/Eck subfamily; membrane spanning protein tyrosine kinaseSpecies Mouse (Mus musculus) [TaxId:10090] [69828] (1 PDB entry) 
Domain d1jpaa_: 1jpa A: [67011]
complexed with anp
Details for d1jpaa_
PDB Entry: 1jpa (more details), 1.91 Å
PDB Description: crystal structure of unphosphorylated ephb2 receptor tyrosine kinase and juxtamembrane region
PDB Compounds: (A:) neural kinase, Nuk=Eph/Elk/Eck family receptor-like tyrosine kinaseSCOPe Domain Sequences for d1jpaa_:
Sequence, based on SEQRES records: (download)
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklpgkreifvaik
tlksgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrq
ndgqftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfglsrfled
dtsdptytsalggkipirwtapeaiqyrkftsasdvwsygivmwevmsygerpywdmtnq
dvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgqivntldkmirnpnslka
Sequence, based on observed residues (ATOM records): (download)
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklreifvaiktlk
sgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrqndg
qftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfpirwtapeaiq
yrkftsasdvwsygivmwevmsygerpywdmtnqdvinaieqdyrlpppmdcpsalhqlm
ldcwqkdrnhrpkfgqivntldkmirnpnslka
SCOPe Domain Coordinates for d1jpaa_:
Click to download the PDB-style file with coordinates for d1jpaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jpaa_:
- d1jpaa_ first appeared in SCOP 1.59
- d1jpaa_ appears in SCOPe 2.07
View in 3D
