Lineage for d1jnrb_ (1jnr B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192801Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2192802Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes N-terminal partly folded tail
  7. 2192803Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)
  8. 2192804Domain d1jnrb_: 1jnr B: [66969]
    Other proteins in same PDB: d1jnra1, d1jnra2, d1jnra3, d1jnrc1, d1jnrc2, d1jnrc3
    complexed with fad, gol, sf4

Details for d1jnrb_

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
PDB Compounds: (B:) adenylylsulfate reductase

SCOPe Domain Sequences for d1jnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOPe Domain Coordinates for d1jnrb_:

Click to download the PDB-style file with coordinates for d1jnrb_.
(The format of our PDB-style files is described here.)

Timeline for d1jnrb_: