Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Adenylylsulfate reductase B subunit [69726] (1 species) includes N-terminal partly folded tail |
Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries) |
Domain d1jnrb_: 1jnr B: [66969] Other proteins in same PDB: d1jnra1, d1jnra2, d1jnra3, d1jnrc1, d1jnrc2, d1jnrc3 complexed with fad, gol, sf4 |
PDB Entry: 1jnr (more details), 1.6 Å
SCOPe Domain Sequences for d1jnrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]} psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep teealksellagepeiigtsefpqvkkka
Timeline for d1jnrb_: