Lineage for d1jnia_ (1jni A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778525Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 778526Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 778614Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 778695Protein Periplasmic nitrate reductase subunit NapB [74805] (2 species)
  7. 778696Species Haemophilus influenzae [TaxId:727] [74806] (1 PDB entry)
  8. 778697Domain d1jnia_: 1jni A: [71761]
    complexed with hem

Details for d1jnia_

PDB Entry: 1jni (more details), 1.25 Å

PDB Description: structure of the napb subunit of the periplasmic nitrate reductase from haemophilus influenzae.
PDB Compounds: (A:) diheme cytochrome c napb

SCOP Domain Sequences for d1jnia_:

Sequence, based on SEQRES records: (download)

>d1jnia_ a.138.1.3 (A:) Periplasmic nitrate reductase subunit NapB {Haemophilus influenzae [TaxId: 727]}
nqppmvphsvanyqvtknvnqclnchspensrlsgatrispthfmdrdgkvgssssprry
fclqchvs

Sequence, based on observed residues (ATOM records): (download)

>d1jnia_ a.138.1.3 (A:) Periplasmic nitrate reductase subunit NapB {Haemophilus influenzae [TaxId: 727]}
nqppmvphsvanyqvtknvnqclnchspensrlsgatrispthfmdrdgkvsprryfclq
chvs

SCOP Domain Coordinates for d1jnia_:

Click to download the PDB-style file with coordinates for d1jnia_.
(The format of our PDB-style files is described here.)

Timeline for d1jnia_: