Lineage for d1jnfa2 (1jnf A:335-676)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.2: Transferrin [53888] (4 proteins)
further duplication: composed of two two-domain lobesProtein Transferrin [53897] (3 species) 
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (2 PDB entries) 
Domain d1jnfa2: 1jnf A:335-676 [63197]
complexed with cl, co3, fe
Details for d1jnfa2
PDB Entry: 1jnf (more details), 2.6 Å
PDB Description: rabbit serum transferrin at 2.6 a resolution.
PDB Compounds: (A:) serotransferrinSCOPe Domain Sequences for d1jnfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnfa2 c.94.1.2 (A:335-676) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
lqdeckavkwcalghherlkcdewsvtsggliecesaetpedciakimngeadamsldgg
yvyiagqcglvpvlaenyestdckkapeegylsvavvkksnpdinwnnlegkkschtavd
rtagwnipmgllynrinhcrfdeffrqgcapgsqknsslcelcvgpsvcapnnregyygy
tgafrclvekgdvafvksqtvlqntggrnsepwakdlkeedfellcldgtrkpvseahnc
hlakapnhavvsrkdkaacvkqklldlqvefgntvadcsskfcmfhsktkdllfrddtkc
lvdlrgkntyekylgadyikavsnlrkcstsrlleactfhkh
SCOPe Domain Coordinates for d1jnfa2:
Click to download the PDB-style file with coordinates for d1jnfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jnfa2:
- d1jnfa2 first appeared in SCOP 1.57
- d1jnfa2 appears in SCOPe 2.05
- d1jnfa2 appears in SCOPe 2.07
- d1jnfa2 appears in the current release, SCOPe 2.08
View in 3D
