Lineage for d1jmug_ (1jmu G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005885Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily)
    unusual fold
  4. 3005886Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family) (S)
    automatically mapped to Pfam PF00979
  5. 3005887Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein)
  6. 3005888Protein Outer capsid protein sigma 3 [64467] (1 species)
  7. 3005889Species Reovirus [TaxId:10891] [64468] (3 PDB entries)
  8. 3005892Domain d1jmug_: 1jmu G: [66894]
    Other proteins in same PDB: d1jmu.1, d1jmu.2, d1jmu.3
    complexed with bog, cl, so4, zn

Details for d1jmug_

PDB Entry: 1jmu (more details), 2.8 Å

PDB Description: crystal structure of the reovirus mu1/sigma3 complex
PDB Compounds: (G:) sigma 3 protein

SCOPe Domain Sequences for d1jmug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmug_ d.196.1.1 (G:) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]}
mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs
lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr
vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv
pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk
elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd
svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd
pmilg

SCOPe Domain Coordinates for d1jmug_:

Click to download the PDB-style file with coordinates for d1jmug_.
(The format of our PDB-style files is described here.)

Timeline for d1jmug_: